PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_10677_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family SBP
Protein Properties Length: 466aa    MW: 50685.2 Da    PI: 8.8207
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_10677_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.98.1e-40176253178
                                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT------ CS
                                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerr 73 
                                           +CqvegC+ dls+akeyhr+h+vC+ hsk+p+v+v gle+rfCqqCsrfh+l efDe+krsCrrrL++hn+rr
  cra_locus_10677_iso_1_len_2316_ver_3 176 RCQVEGCNLDLSSAKEYHRKHRVCDGHSKCPKVTVGGLERRFCQQCSRFHSLLEFDEKKRSCRRRLSDHNARR 248
                                           6************************************************************************ PP

                                           -S--- CS
                                   SBP  74 rkkqa 78 
                                           rk+++
  cra_locus_10677_iso_1_len_2316_ver_3 249 RKPRQ 253
                                           **986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-32169238IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.385174251IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-37175256IPR004333Transcription factor, SBP-box
PfamPF031103.8E-30177250IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010358Biological Processleaf shaping
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MEWSGKWDWD NLVMFNSKAS ESLKKLQLTD WEVEDGGEIA AGSFNLSGSG VGSGGSCSDL  60
AHGSSVKSSM SASTDSSSKE GIKPSGFTFE AFESSSGAIT KKMVPARAEL SGTSSPLEAS  120
VVSVELPISL KLGKRSFFEN NSSDSNAKSL ASVVPVSSSA AVKKTKSSSQ NTSIPRCQVE  180
GCNLDLSSAK EYHRKHRVCD GHSKCPKVTV GGLERRFCQQ CSRFHSLLEF DEKKRSCRRR  240
LSDHNARRRK PRQETIQFHS GKLSSSCYDG RQQMNFALNN IKSAGNSSWE TVYSAKFTLT  300
KDFPLKSEKA GQPSVPGLHL PYAIPMHSSP SNGVSACKST PAKAFTQGFK ETIFSTNLDD  360
SATEFPRALS LLSTNSWVSS EPESISFDQQ HLHANPPTSS MSLPVIHSIP QGLTFASSDY  420
WHTQQQNSAS PNNLHNNNSS SNSGGQSHEI RPFKPHYQDI YSNALN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-26168250284squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1232249KKRSCRRRLSDHNARRRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086805.11e-148PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_011086806.11e-148PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_011086807.11e-148PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_011086808.11e-148PREDICTED: squamosa promoter-binding-like protein 12
TrEMBLA0A068V0E11e-169A0A068V0E1_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000847341e-145(Solanum tuberosum)